PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008352
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 224aa    MW: 25246.6 Da    PI: 8.0624
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008352genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.73.6e-31144202159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk s+ prsYYrCt+++C+vkk+++r ++d++vv++tYeg Hnh+
  DCAR_008352 144 LDDGYKWRKYGQKSVKHSKQPRSYYRCTHHTCNVKKQIQRLSKDNSVVVTTYEGIHNHP 202
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-31131202IPR003657WRKY domain
SuperFamilySSF1182906.67E-27136203IPR003657WRKY domain
PROSITE profilePS5081128.07139204IPR003657WRKY domain
SMARTSM007744.6E-34144203IPR003657WRKY domain
PfamPF031062.2E-24145202IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDEDSIPPPP PPPPPFLTEN VIADDNNDDI FPHFLNSSLI FPSMSQNPYY PTNGSLVTQN  60
SQFAMENIDW MSAMINSKPM EDCNQMPPST CAPVLSSMDN TPNISSGGGD CQNNCINKRK  120
GTGKTKKPIP PRVAFHTRSS EDILDDGYKW RKYGQKSVKH SKQPRSYYRC THHTCNVKKQ  180
IQRLSKDNSV VVTTYEGIHN HPCEKLMETL SPLLRQLQFL SRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-22132201271WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509864.25e-69PREDICTED: probable WRKY transcription factor 43
SwissprotQ9FFS35e-56WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLB9RCI09e-69B9RCI0_RICCO; WRKY transcription factor, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63742433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.11e-55WRKY DNA-binding protein 24